Loading...
Statistics
Advertisement

AM:TIC(E) | Bouquet d'idées, pensées éparpillées et portfolio ...
www.amtice.com/
Bouquet d'idées, pensées éparpillées et portfolio professionnel.

Amtice.com

Advertisement
Conversion Technology Metas Server
Amtice.com is hosted in United States / San Francisco . Amtice.com uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Amtice.com

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes
  • SVG

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Amtice.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 305824697402169823231304834028145237636840
    • validFrom: 160404105900Z
    • validTo: 160703105900Z
    • validFrom_time_t: 1459767540
    • validTo_time_t: 1467543540
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 87:31:32:E9:5B:BB:9F:C8:1F:62:6D:1C:ED:86:04:10:53:63:F0:5B
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:amsterdampornguide.com, DNS:amsterdamprivateboattour.com, DNS:amsterdamrxp.com, DNS:amsterdamsel.com, DNS:amsterdamspurs.com, DNS:amsterdamwhitneygallery.com, DNS:amsterdogblog.com, DNS:amsthinktank.com, DNS:amstohr.com, DNS:amsuganda.org, DNS:amtaes-asociacion.com, DNS:amtales.com, DNS:amtastudentblog.com, DNS:amtaxidermy.com, DNS:amtayouradvantage.com, DNS:amtbvancouver.com, DNS:amtea.net, DNS:amtextilesolutions.com, DNS:amtfdizi.com, DNS:amtgala.com, DNS:amth.org, DNS:amthirdpartyreport.com, DNS:amthompson.net, DNS:amtice.com, DNS:amtlecolemusique.com, DNS:amtlive.org, DNS:amtlpaul.com, DNS:amtonberg.com, DNS:amtphotographynyc.com, DNS:amtrakcareersnewsletter.com, DNS:amtrakmarketfridaysweepstakes.com, DNS:amtraknews.com, DNS:amtraveltimes.com, DNS:amtup.net, DNS:amtuusimaa.net, DNS:amtzweinull.com, DNS:amuciq.org, DNS:amuddylife.com, DNS:amuddymess.com, DNS:amughalffull.com, DNS:amulet-project.org, DNS:amulethunter.com, DNS:amuletsbymerlin.me, DNS:amuletstrange.com, DNS:amulmago.com, DNS:amulyabodden.com, DNS:amulyadatla.com, DNS:amulyagopalakrishnan.com, DNS:amumandotherthings.com, DNS:amumediation.com, DNS:tls.automattic.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Amtice.com

Number of occurences: 11
  • Name:
    Content: fr_CA
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #ffffff
  • Name: application-name
    Content: AM:TIC(E)
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: Bouquet d'idées, pensées éparpillées et portfolio professionnel.
  • Name: msapplication-task
    Content: name=Forums WordPress.com;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: AM:TIC(E) sur WordPress.com
  • Name: description
    Content: Bouquet d'idées, pensées éparpillées et portfolio professionnel.

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns1.wordpress.com
  • ns3.wordpress.com
  • ns2.wordpress.com
  • ASPMX3.GOOGLEMAIL.com
  • ASPMX.L.GOOGLE.com
  • ALT2.ASPMX.L.GOOGLE.com
  • ASPMX2.GOOGLEMAIL.com
  • ALT1.ASPMX.L.GOOGLE.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 23 Apr 2016 10:51:52 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Location: https://amtice.com/ X-ac: 3.ams _dca HTTP/1.1 200 OK Server: nginx Date: Sat, 23 Apr 2016 10:51:52 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.ams _dca

DNS

host: amtice.com
  1. class: IN
  2. ttl: 297
  3. type: A
  4. ip: 192.0.78.24
host: amtice.com
  1. class: IN
  2. ttl: 297
  3. type: A
  4. ip: 192.0.78.25
host: amtice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: amtice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: amtice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: amtice.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 50
  5. target: ASPMX3.GOOGLEMAIL.com
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: ASPMX.L.GOOGLE.com
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 30
  5. target: ALT2.ASPMX.L.GOOGLE.com
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 40
  5. target: ASPMX2.GOOGLEMAIL.com
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 20
  5. target: ALT1.ASPMX.L.GOOGLE.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.mtice.com, www.aomtice.com, www.omtice.com, www.apmtice.com, www.pmtice.com, www.a9mtice.com, www.9mtice.com, www.amtice.com, www.mtice.com, www.aimtice.com, www.imtice.com, www.aumtice.com, www.umtice.com, www.atice.com, www.amptice.com, www.aptice.com, www.amotice.com, www.aotice.com, www.amitice.com, www.aitice.com, www.amktice.com, www.aktice.com, www.am.tice.com, www.a.tice.com, www.amutice.com, www.autice.com, www.amjtice.com, www.ajtice.com, www.amntice.com, www.antice.com, www.am-tice.com, www.a-tice.com, www.amice.com, www.amtqice.com, www.amqice.com, www.amtaice.com, www.amaice.com, www.amt ice.com, www.am ice.com, www.amtwice.com, www.amwice.com, www.amteice.com, www.ameice.com, www.amtzice.com, www.amzice.com, www.amtxice.com, www.amxice.com, www.amtcice.com, www.amcice.com, www.amtce.com, www.amtirce.com, www.amtrce.com, www.amtifce.com, www.amtfce.com, www.amtivce.com, www.amtvce.com, www.amtikce.com, www.amtkce.com, www.amti,ce.com, www.amt,ce.com, www.amtibce.com, www.amtbce.com, www.amtigce.com, www.amtgce.com, www.amtitce.com, www.amttce.com, www.amtiyce.com, www.amtyce.com, www.amtiuce.com, www.amtuce.com, www.amtijce.com, www.amtjce.com, www.amtimce.com, www.amtmce.com, www.amtince.com, www.amtnce.com, www.amtie.com, www.amticde.com, www.amtide.com, www.amticre.com, www.amtire.com, www.amticte.com, www.amtite.com, www.amticve.com, www.amtive.com, www.amticfe.com, www.amtife.com, www.amticge.com, www.amtige.com, www.amtiche.com, www.amtihe.com, www.amticne.com, www.amtine.com, www.amticme.com, www.amtime.com, www.amticje.com, www.amtije.com, www.amtic.com, www.amticex.com, www.amticx.com, www.amtices.com, www.amtics.com, www.amticew.com, www.amticw.com, www.amticer.com, www.amticr.com, www.amticef.com, www.amticf.com, www.amticev.com, www.amticv.com, www.amticec.com, www.amticc.com, www.amticeq.com, www.amticq.com, www.amticea.com, www.amtica.com, www.amticey.com, www.amticy.com,

Other websites we recently analyzed

  1. ISO Certification Denver, Colorado ISO 9001 AS 9100 ISO 14001 ISO 18801 Boulder, Colorado Spring, Aurora, Lakewood
    WCS Quality Registrars LLC is a highly respected and reputable Quality Registrar based in Houston, TX with Regional Offices in Denver, CO, Dallas, TX, San Jose, CA and Tulsa, OK. We provide ISO 9001 Audit and Certification
    Scottsdale (United States) - 97.74.144.153
    Server software: Apache
    Technology: CSS, Html, Html5, Php, Swf Object
    Number of meta tags: 2
  2. 1 Oak LLC
    1 Oak LLC
    Scottsdale (United States) - 50.63.202.28
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 1
  3. Gadget Shopping at Cyprus
    Shopping on the net with charge cards is a problem for most of US because the internet's beginning. As the web has developed and enhanced and fresh protection
    Austin (United States) - 198.54.114.196
    Server software: Apache
    Technology: Carousel, CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Histats, Wordpress
    Number of Javascript: 6
    Number of meta tags: 4
  4. Crossathletik
    DESCRIPTION HERE
    Mountain View (United States) - 64.233.166.214
    Server software: GSE
    Technology: Google Adsense, CSS, Html, Iframe, Javascript, jQuery Cycle, Php, Add This, Facebook Box, Google +1 Button
    Number of Javascript: 7
    Number of meta tags: 4
  5. 阿哆仔の海屋 Ocean Lounge Beach House – Toucheng, Taiwan B&B 宜蘭頭城海景民宿
    Scottsdale (United States) - 173.201.216.4
    Server software: Apache
    Technology: CSS, Fancybox, Html, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 7
    Number of meta tags: 4
  6. Start - Kellerer Reisen 
    Beschreibung
    Germany - 78.111.239.31
    Server software: Apache/2.2.16 (Debian)
    Technology: CSS, Google Font API, Html, Javascript, jQuery UI, Php, Google Analytics
    Number of Javascript: 6
    Number of meta tags: 7
  7. Rennfahrerschule
    Germany - 85.10.244.185
    Server software: Apache/2.4.10 (Debian)
    Technology: CSS, Gravatar, Html, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress, Share This Social Media Buttons
    Number of Javascript: 12
    Number of meta tags: 3
  8. Naše doména www.z-trailer.fr parkuje u CZECHIA.COM
    Naši doménu www.z-trailer.fr spravuje registrátor RegZone.cz na profesionálním hostingu od CZECHIA.COM. Využijte jejich služeb stejně jako my a získáte skvělou parkovací stránku, špičkové technologické zázemí, nonstop podporu a mnoho dalších výhod.
    Czech Republic - 217.198.116.188
    G Analytics ID: UA-290875-69
    Server software: Apache/2.2.22 (Debian)
    Technology: CSS, Google Font API, Html, Html5, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 6
  9. westpharmaceuticalservices.biz
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  10. VIP Internet | Domeinnaam is gereserveerd -
    Netherlands - 109.106.161.62
    Server software: Apache/2.2.15 (CentOS)
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, Pingback, Google Analytics, Google Tagmanager, Hotjar, Wordpress, Share This Social Media Buttons
    Number of Javascript: 15
    Number of meta tags: 7

Check Other Websites