Loading...
Statistics
Advertisement

AM:TIC(E) | Bouquet d'idées, pensées éparpillées et portfolio ...
www.amtice.com/
Bouquet d'idées, pensées éparpillées et portfolio professionnel.

Amtice.com

Advertisement
Conversion Technology Metas Server
Amtice.com is hosted in United States / San Francisco . Amtice.com uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Amtice.com

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes
  • SVG

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Amtice.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 305824697402169823231304834028145237636840
    • validFrom: 160404105900Z
    • validTo: 160703105900Z
    • validFrom_time_t: 1459767540
    • validTo_time_t: 1467543540
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 87:31:32:E9:5B:BB:9F:C8:1F:62:6D:1C:ED:86:04:10:53:63:F0:5B
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:amsterdampornguide.com, DNS:amsterdamprivateboattour.com, DNS:amsterdamrxp.com, DNS:amsterdamsel.com, DNS:amsterdamspurs.com, DNS:amsterdamwhitneygallery.com, DNS:amsterdogblog.com, DNS:amsthinktank.com, DNS:amstohr.com, DNS:amsuganda.org, DNS:amtaes-asociacion.com, DNS:amtales.com, DNS:amtastudentblog.com, DNS:amtaxidermy.com, DNS:amtayouradvantage.com, DNS:amtbvancouver.com, DNS:amtea.net, DNS:amtextilesolutions.com, DNS:amtfdizi.com, DNS:amtgala.com, DNS:amth.org, DNS:amthirdpartyreport.com, DNS:amthompson.net, DNS:amtice.com, DNS:amtlecolemusique.com, DNS:amtlive.org, DNS:amtlpaul.com, DNS:amtonberg.com, DNS:amtphotographynyc.com, DNS:amtrakcareersnewsletter.com, DNS:amtrakmarketfridaysweepstakes.com, DNS:amtraknews.com, DNS:amtraveltimes.com, DNS:amtup.net, DNS:amtuusimaa.net, DNS:amtzweinull.com, DNS:amuciq.org, DNS:amuddylife.com, DNS:amuddymess.com, DNS:amughalffull.com, DNS:amulet-project.org, DNS:amulethunter.com, DNS:amuletsbymerlin.me, DNS:amuletstrange.com, DNS:amulmago.com, DNS:amulyabodden.com, DNS:amulyadatla.com, DNS:amulyagopalakrishnan.com, DNS:amumandotherthings.com, DNS:amumediation.com, DNS:tls.automattic.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Amtice.com

Number of occurences: 11
  • Name:
    Content: fr_CA
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #ffffff
  • Name: application-name
    Content: AM:TIC(E)
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: Bouquet d'idées, pensées éparpillées et portfolio professionnel.
  • Name: msapplication-task
    Content: name=Forums WordPress.com;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: AM:TIC(E) sur WordPress.com
  • Name: description
    Content: Bouquet d'idées, pensées éparpillées et portfolio professionnel.

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns1.wordpress.com
  • ns3.wordpress.com
  • ns2.wordpress.com
  • ASPMX3.GOOGLEMAIL.com
  • ASPMX.L.GOOGLE.com
  • ALT2.ASPMX.L.GOOGLE.com
  • ASPMX2.GOOGLEMAIL.com
  • ALT1.ASPMX.L.GOOGLE.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 23 Apr 2016 10:51:52 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Location: https://amtice.com/ X-ac: 3.ams _dca HTTP/1.1 200 OK Server: nginx Date: Sat, 23 Apr 2016 10:51:52 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.ams _dca

DNS

host: amtice.com
  1. class: IN
  2. ttl: 297
  3. type: A
  4. ip: 192.0.78.24
host: amtice.com
  1. class: IN
  2. ttl: 297
  3. type: A
  4. ip: 192.0.78.25
host: amtice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: amtice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: amtice.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: amtice.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 50
  5. target: ASPMX3.GOOGLEMAIL.com
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: ASPMX.L.GOOGLE.com
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 30
  5. target: ALT2.ASPMX.L.GOOGLE.com
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 40
  5. target: ASPMX2.GOOGLEMAIL.com
host: amtice.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 20
  5. target: ALT1.ASPMX.L.GOOGLE.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.mtice.com, www.aomtice.com, www.omtice.com, www.apmtice.com, www.pmtice.com, www.a9mtice.com, www.9mtice.com, www.amtice.com, www.mtice.com, www.aimtice.com, www.imtice.com, www.aumtice.com, www.umtice.com, www.atice.com, www.amptice.com, www.aptice.com, www.amotice.com, www.aotice.com, www.amitice.com, www.aitice.com, www.amktice.com, www.aktice.com, www.am.tice.com, www.a.tice.com, www.amutice.com, www.autice.com, www.amjtice.com, www.ajtice.com, www.amntice.com, www.antice.com, www.am-tice.com, www.a-tice.com, www.amice.com, www.amtqice.com, www.amqice.com, www.amtaice.com, www.amaice.com, www.amt ice.com, www.am ice.com, www.amtwice.com, www.amwice.com, www.amteice.com, www.ameice.com, www.amtzice.com, www.amzice.com, www.amtxice.com, www.amxice.com, www.amtcice.com, www.amcice.com, www.amtce.com, www.amtirce.com, www.amtrce.com, www.amtifce.com, www.amtfce.com, www.amtivce.com, www.amtvce.com, www.amtikce.com, www.amtkce.com, www.amti,ce.com, www.amt,ce.com, www.amtibce.com, www.amtbce.com, www.amtigce.com, www.amtgce.com, www.amtitce.com, www.amttce.com, www.amtiyce.com, www.amtyce.com, www.amtiuce.com, www.amtuce.com, www.amtijce.com, www.amtjce.com, www.amtimce.com, www.amtmce.com, www.amtince.com, www.amtnce.com, www.amtie.com, www.amticde.com, www.amtide.com, www.amticre.com, www.amtire.com, www.amticte.com, www.amtite.com, www.amticve.com, www.amtive.com, www.amticfe.com, www.amtife.com, www.amticge.com, www.amtige.com, www.amtiche.com, www.amtihe.com, www.amticne.com, www.amtine.com, www.amticme.com, www.amtime.com, www.amticje.com, www.amtije.com, www.amtic.com, www.amticex.com, www.amticx.com, www.amtices.com, www.amtics.com, www.amticew.com, www.amticw.com, www.amticer.com, www.amticr.com, www.amticef.com, www.amticf.com, www.amticev.com, www.amticv.com, www.amticec.com, www.amticc.com, www.amticeq.com, www.amticq.com, www.amticea.com, www.amtica.com, www.amticey.com, www.amticy.com,

Other websites we recently analyzed

  1. Welcome to Jointechuae
    India - 113.30.140.32
    Server software: Apache/2.4.3 (Unix) OpenSSL/1.0.0-fips PHP/5.4.23
    Technology: Carousel, CSS, Html, Html5, jQuery Validate
    Number of Javascript: 13
    Number of meta tags: 4
  2. Domov
    Slovenia - 109.202.120.135
    Server software: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: AJAX Libraries API, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, Php
    Number of Javascript: 16
    Number of meta tags: 3
  3. โรงเรียนบ้านท่ามะนาว
    Thailand - 122.155.3.77
    Server software: Apache/2
    Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Histats, Facebook Box
    Number of Javascript: 1
    Number of meta tags: 1
  4. Computers Shops Newry - Computer Repair Shop - Newry Computer Centre Ltd
    Newry Computer Center (NCC) is an established supplier of IT systems and services, delivering excellent customer support and computer repair services,
    United Kingdom - 94.136.51.106
    Server software: Microsoft-IIS/7.5
    Technology: Carousel, CSS, Html, Javascript, jQuery Cycle, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 6
  5. We'll Have More Soon
    Berlin (Germany) - 85.214.48.44
    Server software: Apache
    Technology: Html
  6. Истёк срок регистрации доменаciti-mobi.ru
    Russian Federation - 194.58.56.131
    G Analytics ID: UA-55552418-3
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, Php, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 4
  7. ODOT I-5 Paving and Signs Project | SW Capitol Highway to N. Lombard Avenue
    Houston (United States) - 192.254.190.210
    Server software: squid/3.5.14
    Technology: BootstrapCDN, Maxcdn, Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery Fancybox, Php, Google Analytics
    Number of Javascript: 7
    Number of meta tags: 4
  8. MAZ - maz - mein autozentrum
    Berlin (Germany) - 81.169.145.150
    G Analytics ID: UA-77647069-1
    Server software: Apache/2.2.31 (Unix)
    Technology: CSS, Html, Html5, Javascript, jQuery Colorbox, jQuery UI, Php, SVG, Google Analytics
    Number of Javascript: 6
    Number of meta tags: 6
  9. Home - Family Home Solutions
    Find out how Family Home Solutions will help you buy an affordable home, repair your credit, invest in real estate without a hassle by contacting us.
    Dallas (United States) - 198.58.114.35
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, New Relic, Wordpress
    Number of Javascript: 7
    Number of meta tags: 4
  10. Wir über uns
    Weiterbildung & sonstige Bildungsstätten - Bildungswerkstatt Migration & Gesellschaft
    Berlin (Germany) - 81.169.145.92
    Server software: Apache/2.2.31 (Unix)
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3

Check Other Websites